99% Pure Lyophilized Powder in 3ml vial (NOT A LIQUID) – If Reconstitution is desired, please purchase our Reconstitution Solution, HERE
Cagrilintide
Price range: $79.99 through $149.99
Certificate of Analysis
Want a shortcut to research?
Dispatched Within 24 Hours
Referenced in Human Studies
Third-Party COA Verified
Sourced from Trusted Labs in EU
Scientific Advisory Oversight
Cagrilintide is a long-acting analogue of amylin, a naturally occurring peptide that is released in conjunction with insulin. Cagrilintide has shown promise in animal trials as a treatment for obesity and type 2 diabetes. It has been studied for benefits not just in type 2 diabetes, but for liver damage, alcohol-related liver disease, and heart/blood vessel disease. There is some speculation about the role of this peptide in Alzheimer’s disease as well, but no research has been published in that particular sub-domain, yet. Many trials, however, have looked at the combination of cagrilintide and semaglutide in the treatment of obesity and type 2 diabetes. The two proteins appear to work synergistically to provide more robust and more permanent weight loss effects.
Store in a cool, dry place away from light.If Constituted, Please RefrigerateFor long-term storage, freezing at -20°C is recommended to maintain integrity.
Retatrutide / Cagrilintide Peptide Structure
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂ · xC₂H₄O₂
Molecular Weight: 4409.01 g/mol
PubChem SID: 171397054
CAS Number: 1415456-99-3
Synonyms: AT42613, AM833

Orders will typically be fulfilled to the following carriers within 24 hours of payment. USPS – (2 – 8 Business Days) UPS – (1 – 6 Business Days) *UPS HIGHLY RECOMMENDED*
Disclaimer: – This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
Frequently Asked Questions
Our local team are here to help
Have more questions about peptide research? You’re not alone. Explore our Frequently Asked Questions for quick answers—or head to the Knowledge Base to explore study areas, calculators, and protocol guides.
Cagrilintide is studied for its activity on amylin receptors and its potential role in appetite signaling and satiety regulation in metabolic research.
It’s typically studied alongside GLP-1 analogs for synergistic exploration of metabolic function.
Keep refrigerated post-mixing and avoid excessive light or heat exposure.





